PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_21290V3.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2581aa    MW: 276304 Da    PI: 6.458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_21290V3.7.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29.2e-0912231266347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                           WT  E el+ ++v+++G++ +++Ia ++g++++  qck ++ k 
  Pp3c12_21290V3.7.p 1223 QWTDRERELFTEGVRLFGKD-FERIAVHVGTTKSVGQCKAFFCKT 1266
                          5*****************99.*******************99886 PP

2Myb_DNA-binding33.97.3e-1116451686346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                          +WT+eE e+++d ++ +G++ W++  ++++  ++l q+k ++q+
  Pp3c12_21290V3.7.p 1645 SWTQEEKEKFADIIRNHGKD-WTRLHECLP-SKSLTQIKTYFQN 1686
                          7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.9E-139601023IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-49691016IPR009057Homeodomain-like
PROSITE profilePS5129317.2769721023IPR017884SANT domain
SMARTSM007172.1E-79731021IPR001005SANT/Myb domain
PROSITE profilePS5129317.87812191271IPR017884SANT domain
SMARTSM007171.3E-812201269IPR001005SANT/Myb domain
PfamPF002499.2E-712231265IPR001005SANT/Myb domain
SuperFamilySSF466892.54E-912231273IPR009057Homeodomain-like
CDDcd001671.50E-512241265No hitNo description
SuperFamilySSF466892.83E-1016401690IPR009057Homeodomain-like
PROSITE profilePS512938.54216411692IPR017884SANT domain
SMARTSM007177.1E-916421690IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-716431687IPR009057Homeodomain-like
PfamPF002493.3E-816451686IPR001005SANT/Myb domain
CDDcd001672.32E-616451688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2581 aa     Download sequence    Send to blast
MYSPGRGDAR ATALPNARDS STSMPIDHAS AWHREPYNRD ARLDRGDRER IIGGKREWNS  60
DRASFGAPYP RAFGGLHPVN GSLGPPNKRR LNGRHTGFHN EGGRYVSPGH RGEPPFGSVG  120
PVENGLGRKF DRESFYPGSG CPVGGSGFGN GVGVDQRAKE LEERHKKEPF LLLRDGRDGG  180
SCGGIEHGVR SFPSQAVCEA EKSCWERERS KGAVGNGWES SQKLQRDLRE RVGGKAEGYS  240
RREGKLSQHD GGREWSQADK ELEGRRVDGY GSSSRDGLTG DGVGGIKEAV GGCEWRRKER  300
SSSVSASRSG SYVASSGTAK GPVGRPQALD VSGSASSPQV SPHSTASPGV QEASRDDGSQ  360
PSPPKRPRLG WGQGLAKYEK KKVVETDEVG VSASGGSVSG RERSSVSGAT TEVVQTQESQ  420
AAEESPVSVV SNLSTLPPLT PSASPSQQAA EVVSKAMVEC DGVEQEVVGK VCERVAAEAE  480
AGGWISKPEG VVADDVEKRG NMRAVTECGL EESVRQGECC EALGLKESME CQASPKVRGS  540
VEHCGGVEVG GEVGVSDAGS RWAKEDILLR VEKVEYEIEE VERELAKAEK VGSDRRAAGE  600
WVAGVVGDEG SAGVDGVVKV EDGIDDGEAM DVDAAEVHPG RVDSRESGEA MQVACSGRNW  660
SGGEECGNGR WGSDGAGAAG NVGERVGGGV SEGGHGGSVD DGGVLEEGEL GEEKQEEWTS  720
KQMSVGLESE GNPAYSPRAE TEPAQREEMD VTAGVSKCGV AEKEEAERKV ISWDVEVVAR  780
SLMEENKKRA EQARETFVHL LREGVGVEGT LYRCPAEAGV WKENVERHYR NQERMLEKMG  840
ERRQSLRFAE QVLAMRFRAL KEAWKQEQVG MRQQQRGTKP VRRWEVEKRN GTALHCHRSS  900
LRLRPVQAGM EKVEAVSEEC MKKVMAKAVV GPVRGVLKMP SMIVGQENRL ARRFESKNAL  960
VEDPVGMERE RKSMNPWSWE EKRVFLEKFA VYNKNFSKIA SHLELKTTAD CVEFYYRNQK  1020
SEDFERIRRR QQLKKRRDYS RVGGSFLSTG LQTSSQRREA NGHGRTEGAN VQTVGAVVGV  1080
SHISVGTKAA RSSMQQKPVE RQRVSSALEP GSLPGAVEIG KGVSGKENKW CGTGGVSGSA  1140
AGRGGIFGMV LSGATVSCGL SSAVAGAVKI GRERSSVKTM VDAGLVVASC GQIEQHVSAP  1200
MVTGNGYLQI YLEKSAGKEG DAQWTDRERE LFTEGVRLFG KDFERIAVHV GTTKSVGQCK  1260
AFFCKTRKRL GLDKLVEKYE DSLKVRVGAV MAESPECADV GRGEAAGVLA EDVRVSGLAV  1320
SAGPGMEVES DQDKGDESEK SVEVVLPVDV QEMEAVEAEA GEGVRVEEIV VEEVAVESEV  1380
VEVVPVYNGV LEDVPVHNGV LKEAPVDNGV LEDELVETPS VVSESVSEAV GASCIVSISK  1440
HAMMESGVCL TQSSVILDSV MKAVCEVPAT VAHSMGECGA EVSEDDRVEF VAVEKETFAE  1500
AVEVVVAKDG NTGNNSTDLA IGYVVEEDAA VIRKDAESDM ESCKCEPDTG LVKAVGMLAK  1560
ISTLAADEQE AKAVPTVDVK ADPESPQVAT SLSTDSASFP SLPAAVSHSG GSVFSNSSTQ  1620
GSQQGRERVG RVGGGETKSR REPTSWTQEE KEKFADIIRN HGKDWTRLHE CLPSKSLTQI  1680
KTYFQNSKAK LGLLNAEGVN ILGGRVAGSR KRKVDEAEDG SNNVACLSSG NELKGGGVSA  1740
RDMDGVCQNV KAAVGGVPSM GMGSGPSGLE SMLYPIFGQR VEDQIALEKF MRMYSANGLA  1800
QNIAGGVNPF VQQYGFPMFP NAGHQRASQL SLQQQLAASL AQKSGQAKGL QQQELQGSGS  1860
VQQSGQASVQ QKAAHQLQSA QMVRNQQLLA SMMQHQAAAH HQQNQTSKSV PHPLQPQVVV  1920
LQPGHAGQLQ QQPLVLNQQV IHHPQAQQGG SQQEQGSPGH LVGNPSLGAC SSAQVPNQMK  1980
QLLQHQALLQ QQQFQLALQH LQQQQQQQQL QQHQHHQDQT QAQVQVQAQA QIQALEHSHS  2040
HSQSHIHQPQ YSLASLLQPL VVQKPKVVVP LPPQVTRTPS PPVLQQGGLP HRHDQHQHGP  2100
SHTFLRGNVA SAVSSNPGEA STQQGEIGEQ WGSISHGGGS KERNFSRADL HQLSGAGQMV  2160
KPSNAEPSRP ATESPQARIG DVKLFGQSLL SQPTSCAVSQ NVARGSFSAA EKVSLQQSPV  2220
STAVSSLATS MPVPAASRVK PYGKESAFRG VPFSSEGRQG GWPPLGNRGS MEMWNIMNNA  2280
HSQVGQVLKS KVEELELHNM QECRMSREAQ DAESDQSTPK STHKPQHLEQ ARGAQDKSGS  2340
GGFSSLAYGV GKSRACVNEH GVSSGEVSRT DPERRGESIG LDSGCSERSS MMASRSSRGQ  2400
AESFAMQATG PFANGQQVPR TVIDALMAIA ELHRIRSSQF NSSVGQPRLE DHQWESLVQH  2460
TTKGMAVDAV KANPSLSLNR PIATPQTHLR GNGVSQHCVR DSGLYFTQHY PNLPGQSGVV  2520
SSAWNGGTGL VHPCDVQRML VNPALSSFLP SALSRASTAT EKYLGSSEVR DSDGGRDGTC  2580
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-159311025194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-159311025194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109160.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769009.10.0predicted protein
TrEMBLA9SRK80.0A9SRK8_PHYPA; Predicted protein
STRINGPP1S143_55V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.19e-35MYB family protein